DPCstruct | MC43804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 18.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF16352- CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380ZGQ1 | 76-210 | YLLLPIQESSKEGLVRLDTGSPADTDMDVRLATDSVEYYVPFALPQGSEEATVIIKKVAADALCWDSIRVSDTFDTANRDKFRPVYH… |
| A0A3L7PB76 | 2-148 | VLLIHSLPCLHAGQATEDDVLIDGVQEVVNDIELADANPDWWALMDVSAWTGRKLTVKVDRLLEDSQALQSITLTDSEGGGQSFYQE… |
| A0A2X2UUD1 | 2-177 | None |
| Z4WRR5 | 29-192 | None |
| A0A3M8FH78 | 11-180 | None |
| U1SIS6 | 3-161 | None |
| A0A7C6XV43 | 1-149 | None |
| A0A496MIZ6 | 187-329 | None |
| A0A422LNR1 | 113-234 | None |
| A0A183BW44 | 29-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.