DPCstruct | MC43801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1G6W5 | 97-187 | KQVHVGEHDPQYGDYEAAEGWAWGRGNTLLLDLGDRRCAYIGEAVWTFELAAGEEIATYYSTVGNSDVPYPCLYTGNRVYDMVDRHW… |
| A0A6C0KVT2 | 99-177 | IKTKKIYIGGEKRERGNSIVLHLSGNKYMHIGCEIYEFHMEDEVDSYFSIIGNSDVPYPVLLGTEYVYFMLDYRYVPRT |
| A0A6C0HMK1 | 52-163 | None |
| A0A6C0DGR0 | 56-135 | None |
| A0A2J7ZLM5 | 107-217 | None |
| A0A812R240 | 142-239 | None |
| A0A6C0CNB7 | 41-117 | None |
| A0A6C0C985 | 89-169 | None |
| A0A6C0C6X1 | 182-276 | None |
| A0A6C0I1U7 | 187-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.