DPCstruct | MC4380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5GH92 | 42-162 | LDGYWRTVEVLIDGKEQLDHLGLGHVQRVEQRGDRMVVTAGGVIHDMRCDGTLERGVNDVAEFDKATEIHVAATYEDGEHVLRPQGW… |
| A0A2E7XJV7 | 1-106 | MRGLWHGISGRTGHLERIEQCGNRVVVTAYRTIHDFRVDGTLRNGARDIGPACNNFRTANHFDDGVMFFRLFNLFDAVTRRLSGEEM… |
| A0A382XI69 | 8-119 | None |
| A0A2E1UAJ0 | 95-201 | None |
| A0A6J6Y9N4 | 1-123 | None |
| A0A536DZP8 | 40-158 | None |
| A0A7K0NUN3 | 1-112 | None |
| A0A6N2DYV3 | 40-155 | None |
| A0A7S4LFT8 | 272-373 | None |
| A0A381NX37 | 85-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.