DPCstruct | MC43795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9CAZ8 | 152-262 | KIYKEPFARIFPRYVALAKETGHTMEEVGQIVTWLTGYPFERIARHIGRRTELEEFFAEAKLNPKRRLITGSVGGERVESIEDKTVR… |
| A0A0B2BMD5 | 7-113 | TSFASVYPHYVTKVERKGRTKAELDAVIEWLTGFDEATLAKHLEAETTFEDFFAAADLNPNVTLIKGVVCGVRVEEVEDPLMQKIRY… |
| A0A7U1EAK2 | 1-65 | None |
| A0A0G1K5Q7 | 4-116 | None |
| A0A1H7T4V7 | 83-193 | None |
| A0A812K3V7 | 54-160 | None |
| V4QE38 | 2-95 | None |
| A0A1K1WW17 | 100-202 | None |
| A0A1M3D3Q3 | 324-430 | None |
| S0K083 | 12-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.