DPCstruct | MC43792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 253 ± 57 aa |
| Standard deviation of domain lengths | 56.88 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9C5H3 | 57-290 | GSSQTANMIDADGSLVGWNEAAIIGADDEDSETDYRTNEWWRIDDSCQRNLDWGFWLCPTMGHRTVVSLFIMQGLLSSPPQRTHPNT… |
| Q54XG9 | 1124-1392 | MTHGDVFKPQGISTARAISFVNVAKSQIVGHQVLPTSGSRYFNFIDWDSSITGKKPGQPALVGSHELWYKFDNTCEYNSDWTCHICE… |
| A8JJQ1 | 96-356 | None |
| A0A388KP59 | 37-240 | None |
| A0A5A9NKE5 | 105-272 | None |
| A0A820V2N7 | 53-401 | None |
| A0A4V3HH68 | 626-858 | None |
| A0A7S3JIH3 | 3-176 | None |
| A0A6J4SK29 | 256-482 | None |
| A0A7S1V3F9 | 308-723 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.