DPCstruct | MC4379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 185 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7TQJ7 | 2-172 | GWFATDRFLPKDSVCVYTFIPNREVTLIESDDEQYLAKRARISSIKDTWKPGVDYAPLIALAKEKQALPEKEEGKGDFEFIIDDHHT… |
| F3QYL4 | 222-414 | MPFNSPANDYMLAIDEFNQLGWFVSDRNQPEDKVCIYIFIPNDVRKVYDANIYEEDELCRLALIHSIAETWGDKEAVAQARQRLQAA… |
| A0A7J0BA87 | 107-286 | None |
| W4P9N7 | 1-194 | None |
| A0A7X7C315 | 181-366 | None |
| A0A1I5IXR9 | 408-598 | None |
| A0A2T0XFU8 | 290-473 | None |
| F4KMK0 | 259-444 | None |
| W7Y0X9 | 307-491 | None |
| A0A7X8GTN1 | 84-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.