DPCstruct | MC43786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812YAR7 | 540-715 | VQLKELPWLFSGKLPARQMDEKCMPASNTGTVADVLGAGQATKALCLDVGRTLMHQFLLKTSEVQLFEYTVHLAPKGVEDKCGCGFL… |
| A0A812L2Z1 | 59-250 | LRLRELQMVFRGKRPAEAVNEEHVAARPPAWEIDDVLTENDVVNALVLDGGGTREKLQKLLLSFTEVQCFDFSVHCCDVKLATKLGT… |
| A0A813BAP2 | 2-200 | None |
| A0A812QUZ0 | 275-418 | None |
| A0A813AP82 | 165-342 | None |
| A0A812UII5 | 823-998 | None |
| A0A812YQH6 | 234-437 | None |
| A0A812XMR3 | 509-665 | None |
| A0A812N3V7 | 52-234 | None |
| A0A812N194 | 148-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.