DPCstruct | MC4378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.25 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 62.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644ZUU1 | 1-56 | MIGACGISAFPMSARVIHQMGQKEDPYNYLLMPAISANVGGQIGSVVAGGIILTLV |
| A0A7X7RFA1 | 2-63 | NKINPLIGNAGVSAVPDSARVSELIGLTYDRTNHLLMHAMGPNVAGVIGSAVAAGILLGFLS |
| W4P855 | 25-86 | None |
| A0A7Y0S8H6 | 3-64 | None |
| A0A2S6B9Y3 | 36-96 | None |
| A0A8A6AMP5 | 151-214 | None |
| A0A7U7GCZ6 | 68-128 | None |
| X1EFU5 | 80-141 | None |
| A0A841KZI1 | 217-276 | None |
| A0A836TF35 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.