DPCstruct | MC43775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 297 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3YSG8 | 40-179 | NPGPRQTRYLSPLERDDQQISFLSGCVHWMNRPFARPSDGLAPGDYIYVITVDGNFLAIEQQPTDMREVHHSTIPSGKGLICAGHMT… |
| A0A4Q7XZA6 | 6-130 | QARVYPNLNPSAAVPVDRDQIFSLSSFADNYRMRRGKEHGQYVPNARFTFVKLTSGETLMHQRFRHPVLAEGRPVLYAGEAYFNNGK… |
| A0A3D1QUY4 | 20-151 | None |
| A0A2M8WW33 | 432-557 | None |
| A0A3N7G2J1 | 77-213 | None |
| Q3YS63 | 98-235 | None |
| A0A5E4EJE1 | 59-171 | None |
| A0A3G7UCB2 | 109-246 | None |
| A0A268AG62 | 400-512 | None |
| A0A7Y6YZX7 | 481-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.