DPCstruct | MC43773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8C7U8 | 1-90 | MIEDVPLIFGAVFQCTLKMITKNFEDHPEHRLKFFSLLRAIAAHCFPALIGLSSQQIKLVMDSIIWAFRHTEQNIAETGLNLLLAIL… |
| A0A6J2XDR1 | 101-188 | TVEIPKIFDAVFECTLEMINKDFEEFPEHRTNFFLLLQAVNNHCFVAFLNIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILLKLLQN |
| A0A820G6C7 | 69-186 | None |
| A0A0S7KU37 | 100-207 | None |
| A0A396GF20 | 2-77 | None |
| A0A183EAX3 | 265-347 | None |
| A0A287T2D8 | 340-422 | None |
| Q7RP59 | 313-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.