DPCstruct | MC4377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A515YSA6 | 5-87 | LLLTVAQGAVSLLGDQWGAAEGPGGRTGHLRTNHTVFTIGVCEAGDVFLRNDQIGDVRHLPHVNANSSPDDIAEQVAEYIGEL |
| A0A7G8KG26 | 3-102 | EYPYTISEYSRAAVDVLGYGWDGDSGFLGAYGLIWRKADDRTFRVWVDAERDDESRLMVADKDDSARFVEVPLTSEAPTDAESLREV… |
| G2G3J6 | 186-277 | None |
| A0A6B2VPL6 | 5-104 | None |
| A0A6G2XCC3 | 7-134 | None |
| A0A3R7HX23 | 17-139 | None |
| A0A3N6H7B8 | 34-135 | None |
| A0A1H1Z6X7 | 3-88 | None |
| A0A2S9PMS0 | 169-274 | None |
| Q99QM7 | 84-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.