DPCstruct | MC43766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10190 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0X6Q9 | 1-109 | MFATKADPQEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVISVIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEAL… |
| A0A4P9Y1X5 | 1-142 | MSSQRVHVSFTAPDDYTVPSFPSLYWPPTGQNHRNDLYDIYNIWLFTMCWTVIVFFSIYGSTGLWAVWVFRHKSRAAILSPVILSSL… |
| A0A182IUN4 | 240-381 | None |
| A0A6A6NXT2 | 19-184 | None |
| A0A6P6RIE8 | 1-152 | None |
| A0A0L0T9B7 | 1-120 | None |
| A0A1Y1XKM8 | 76-215 | None |
| A0A182EF25 | 10-133 | None |
| A0A3B1IMS2 | 15-158 | None |
| A0A1Y1XNZ1 | 3-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.