DPCstruct | MC43763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J9VGG1 | 23-81 | LLLLAGAADAAPPLVGVSPQDAAYFAPQVIACRDGSGYFPKNRLNDGYCDCADGTDEPG |
| A0A4Y2WU41 | 32-123 | KADGFMQSKSSDKEIKDDVWHAASKVQENIKFILGVLPSSQRFYKPTPRNTFKCIQSGEEINFAFVNDNYCDCSDFSDEPSTSACSS… |
| A0A7R9KGJ2 | 112-175 | None |
| A0A0L9V4U6 | 65-127 | None |
| A0A446PP73 | 3-70 | None |
| A0A5J4N861 | 14-80 | None |
| A0A453FIQ7 | 46-107 | None |
| A0A6S7H331 | 4-68 | None |
| A0A218X104 | 10-78 | None |
| A0A6P5N8G0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.