DPCstruct | MC43761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 308 ± 55 aa |
| Standard deviation of domain lengths | 54.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369JCL2 | 175-455 | NSKREDLTFVLLQFWLLAISVIAIMHDSVPHTLAVLITRGLLTVWSGYAIWRTTFIEGNLQELMFKSGTPCSINIFPSYFTTRISYE… |
| A0A1S8VGQ9 | 13-290 | IVYNQFTAAIDTQEPGPARGIPVYLVIFLLAQVFQIILCWDALIKQNTMQIGSFVAFNLANLSYAIFQYAQLIRIATADIGLSTPLI… |
| A0A401KGW6 | 24-346 | None |
| J4G3T4 | 106-426 | None |
| A0A4Y9ZFV4 | 395-747 | None |
| A0A077WQT4 | 17-282 | None |
| A0A146IG05 | 437-766 | None |
| A0A397SVQ9 | 12-274 | None |
| A0A284QVC3 | 3-243 | None |
| A0A7S3GBC3 | 2-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.