DPCstruct | MC43756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 222 ± 44 aa |
| Standard deviation of domain lengths | 43.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2PGZ8 | 25-242 | PTLLQKGSDGAERGAVRAIGEAVLSEPVQAALARARESLETDGPGAQRVNRKRRRAGTPEEYVDARAAAPARRPEDAVPLAELGAWG… |
| A0A224YK00 | 4-134 | EILRPCGNSAVLKITLSRTLRALVCLRGLIIEWVLVKAFNEDFYTDDDQLDMWSKSRYQVFQKVTEHANAAMLHFFSPQLPDLAVKS… |
| A0A0K9QZ68 | 253-453 | None |
| F4PGZ4 | 307-516 | None |
| A0A1L9T8F0 | 293-567 | None |
| G1T4R8 | 166-409 | None |
| A0A6V7TXG6 | 114-350 | None |
| A0A4Q2D252 | 73-291 | None |
| A0A369RWN6 | 94-338 | None |
| A0A7S1TCL9 | 30-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.