DPCstruct | MC4375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4TWE9 | 1-140 | MRADMFKVIVERPRWGASHAASPKLKGHRTPENQHIGLKRHARIAAPYTKSLNENLRPLVRFLRSRRGQKWDDVFSEICAGLDTGST… |
| A0A3R9MJB9 | 13-150 | MKTSGSKRRYVASGDYADHRREKQPSSFEELPQKEPFQRPSQFYNGKINYDLLRRFLRGQVGQHWNVVHAEILARIPTRLLHYREMI… |
| A0A3B8ICL6 | 1-134 | None |
| A0A7X6URU7 | 1-146 | None |
| A0A1H9TXL1 | 1-119 | None |
| A0A5C7X6A9 | 1-159 | None |
| K9ELW0 | 1-176 | None |
| B9XDR0 | 6-148 | None |
| A0A2S8GIC6 | 32-180 | None |
| A0A225DV81 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.