DPCstruct | MC43747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | CL0369- PF04825- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4E0X6 | 2-127 | VFFTELFSYKRGSLAKIWLAAHWEKKITKAHVFECNLETTVEDIISPQIKIGLRTSGHLLLGVARIYSRKTKYLLADCSDAVVKIKV… |
| A0A5S6QIA0 | 1-141 | MFYSLNILARKDGKFSIVWLAATRANKLSKKQCQAVDLCYSCIELCKHIPSSNRVKGAERFSLYLCSQLMFGIVVIFGKKHEYLLRE… |
| A0A2P4YM93 | 185-298 | None |
| A0A7N0TQH9 | 1-142 | None |
| A0A146H5X4 | 3-165 | None |
| A0A6P5F437 | 1-132 | None |
| J4UGW4 | 393-525 | None |
| A0A6I9YF37 | 1-128 | None |
| A0A446JDW5 | 2-153 | None |
| A0A4Z1HAV6 | 2-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.