DPCstruct | MC43746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 153 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4DNR3 | 3-152 | MFHGHKKCNKQTNEYILWVEICYDLYSPLVRTIEVLKLEKRLDASLLYLRDALPEYSTFDLDMKPVHISPTQDVPVNQMKVKMKPRP… |
| R7TP34 | 127-299 | NRFVGICIQRASYGLRANFTLRNVVDNQGLEIRYDMYSPLIQKVEVLRLEKRLDDELFYLRDAPAEFSTVPFNLEAVSHPPGAPVPV… |
| A0A6P7U0G9 | 67-197 | None |
| A0A1A9UPB1 | 1-115 | None |
| A0A368G650 | 587-732 | None |
| A0A2I4BCG5 | 103-236 | None |
| A0A044UZ17 | 962-1118 | None |
| A0A183S911 | 17-196 | None |
| A0A077YWL9 | 91-250 | None |
| A0A6P7X5W8 | 188-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.