DPCstruct | MC43743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 348 ± 38 aa |
| Standard deviation of domain lengths | 38.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7C315 | 3-366 | EKEFDKYQRANRRNNEALERLDLVREYSTKLQRAINRSEDIQIIDSLVLPKTDFLNAYNLSATSGSVIPINEFFKDRALSLSDKTLF… |
| F3QYL4 | 32-413 | AEYYMNHYQFDEAEELLNQDIKKLKRKRQPTDVEEGKLQKIARLRSMMRATERVTVIDSLVVDKNTFLNHIKLSPESGEISPYGTFF… |
| A0A7Y5ESI0 | 224-522 | None |
| A0A2G6GXJ0 | 100-481 | None |
| A0A523GAI7 | 269-557 | None |
| A0A0Q4AY56 | 19-375 | None |
| A0A7J0BA87 | 13-286 | None |
| A0A7C7CDV4 | 37-318 | None |
| A0A1I5IXR9 | 231-599 | None |
| W7Y0X9 | 114-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.