DPCstruct | MC4374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4AJI9 | 1-74 | MMIEAIREFKRAVPFRPYEIRTNGGERLRVPHPDFILVAPKGSWVMVTDEKDHPRHISALLIEEVAPLRKRTRK |
| A0A517R7A6 | 19-95 | EPIKFTQKIHRLLRARPFRSFRLYLSDGSEFEVRHPESALLTQGGLYIGRYADEQSEIPESDAFCSLLHMTRVEVDE |
| A0A7C4UXC5 | 5-74 | None |
| A0A2E8D149 | 15-92 | None |
| A0A517XPF0 | 4-84 | None |
| A0A2V5QAC1 | 1-77 | None |
| A0A3A0C9P0 | 3-82 | None |
| A0A2V5R8Z4 | 5-71 | None |
| A0A7C4UPN9 | 1-64 | None |
| A0A1G1BV11 | 175-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.