DPCstruct | MC43737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0C3J8 | 2-135 | LTGSRDELLALFPEYEDATYGMYLDKLIPPAWQELQRNGFQLVDTAREDDFVIAGCLLFRNSVEKAEWGSPGNEIRMFWMVLQNHEN… |
| A0A844MTT3 | 15-151 | IFSLAQYIDNHIALNWEPLIRKNIDKLRNVFTKAGDTAYGMYLGWLFLPVHKQLKQALFRPEPRLPGDFSISREWGNQEETEQQRWI… |
| A0A081P1X9 | 33-161 | None |
| A0A6B8RUF9 | 16-147 | None |
| A0A1E1VU67 | 1-112 | None |
| A0A4V3X8G7 | 13-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.