DPCstruct | MC43735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0S4A5 | 9-80 | NAERRWRDGELESVKWLRERHRDEVELGSSTSLSTDEYGELLAYMQLLRDWPQSSKFPVQKYRPKKPSWIAV |
| A0A514BMD0 | 2-68 | WRDAEIERVKWLRERHRDQLEIGTETTLKDEQFSELLLYVQSLRDWPQSSAFPDSEHRPIAAPWIAE |
| A0A5R8ZCX7 | 7-75 | None |
| A0A4R4CAQ6 | 9-100 | None |
| A0A285Z1I6 | 96-173 | None |
| A0A7U1DY84 | 2-64 | None |
| A0A8B0BPM1 | 20-99 | None |
| A0A1D3JVM5 | 118-197 | None |
| Q1I690 | 130-200 | None |
| A0A5B0FZW4 | 46-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.