DPCstruct | MC43733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 27 aa |
| Standard deviation of domain lengths | 26.56 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 91.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F2B033 | 10-121 | KKNAMSLNISNLFACVRPNQKENFPFESMEEYLERKRPDGFSEDPWVRVHEKAGGKRIRIEERSMYVSGSVEQWETWTQMKFPESGS… |
| A0A5F1XYD0 | 68-179 | KKNAMSLNISNLFACVRPNRKENFPFISMEEYLERKRPDGFSEDPWVRVHEKAGGKKIRIEPRSMYVSGSVEEWETWTRMKFPESGS… |
| A0A5C8ZEF5 | 135-246 | None |
| A0A2T6ZAI0 | 279-420 | None |
| A0A1U9ZZB2 | 39-149 | None |
| A0A7C8Q3V4 | 1-208 | None |
| A0A1H9M1G9 | 316-429 | None |
| A0A257RFR9 | 111-222 | None |
| A0A7W5W040 | 3-113 | None |
| V5FXW2 | 144-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.