DPCstruct | MC4373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 263 ± 57 aa |
| Standard deviation of domain lengths | 56.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF07583- PF07587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C555 | 294-611 | SEKYPKNRLGLTQWLFDKQNPLTSRVFVNQVWQEYFGRGLVKTSGDFGMQGELPSHPELLDWLAVDFMNHGWDIKRLVKQIVLSATY… |
| A0A517R598 | 628-871 | ARVAVNHIWLRYFGEPLVANMSDFGLRAKRPRHADLLDWLAAELMSRGWKMKPIHRLIVTSEAYRRASGGHAELTAQSVAVDPDNET… |
| A0A6J4NYY2 | 75-269 | None |
| A0A350KK56 | 4-175 | None |
| A0A7Y5VQF1 | 48-286 | None |
| A0A517ZYA5 | 414-663 | None |
| A0A3D4PPW3 | 23-267 | None |
| A0A7D8YCL1 | 739-1000 | None |
| A0A354T9U0 | 48-225 | None |
| A0A353F6D8 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.