DPCstruct | MC43726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2ZYW7 | 2-101 | WDGLDELDPGWTEHYLTATLQPYESGVLPPQVVQLLCIAVDASCTHMYGPGLQRHIRAALDLGVTAHEILEVLKLATTVGIHSLNLG… |
| A0A6P2U4R9 | 3-122 | DKSALKAEFERLHGYWSDVHDQALAEDPVFFNDYLVMARAALDAGHLEPKLCDLVMIAASASVTHLNGDAVALHIQGALRHGATRQE… |
| A0A846Y9G1 | 11-110 | None |
| A0A420YNF6 | 9-123 | None |
| A0A2W2AS20 | 32-146 | None |
| A0A178AWD2 | 439-565 | None |
| A0A1R1SC14 | 2-85 | None |
| A0A1W7MDD2 | 10-118 | None |
| A0A439D2K0 | 21-124 | None |
| A8S5R3 | 24-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.