DPCstruct | MC43725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 226 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5Z5H3 | 232-449 | LSEANFKEVYFVLTQLEDQLQLSQSDKFNFGFVTSVHDIQGYDSEDVDDLTNSYIKVLEYLKKIGVIKDYSHGAMSLDADVTLDITR… |
| A0A0G1EQ69 | 1-194 | MNMKNENAKLDFINSLLGIVESYTDVIHKVPDKVYFNFPSPHFDISDQKSVLAELKKKKIIAGFKLDDGYFVISKPGRSMLRDYYLK… |
| A0A0G0B0Y1 | 95-346 | None |
| A0A0S7WYI0 | 2-229 | None |
| A0A1F8FNA9 | 13-261 | None |
| A0A2N6A9F4 | 174-390 | None |
| A0A3A4ZJT9 | 291-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.