DPCstruct | MC43720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6SXP9 | 49-98 | MESAGLWEDLPCVVVKGVCDYADSHKNKEWQNFAAATSASVVKALLERYI |
| A0A168CA88 | 1-60 | MEAAGVMTCILVGVIRGVCDYGDEHKNKQWQPYAAAVAAAYAKAVLARIPPKVAVRVEGQ |
| A0A101MAL1 | 34-89 | None |
| A0A4Z0Y5X3 | 23-84 | None |
| A0A0D2H9B2 | 1-73 | None |
| A0A084RZL2 | 1-57 | None |
| A0A3D8RYI5 | 21-75 | None |
| A0A5N5WVE4 | 1-51 | None |
| A0A4S9IUA6 | 83-146 | None |
| A0A4Q7K4V1 | 100-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.