DPCstruct | MC4372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7QNR8 | 18-106 | IKRRLGNWMLRHQLPFNFAIHMVGIPVAVAGIPLLFLYEWYWGVGALFVGYLLQFIGHQVEGNDVGEWAAIKKMLGMKYVGISPRWN… |
| A0A517QZ74 | 1-94 | MLKSFLANYVQRHRDPVNQVLHVIGLPVTFVAPIVFFCLGDVWNGIACFVIGYVLQFLGHAVEGNEAGEVVLVKKWLGFPYVEFGPK… |
| A0A7C2KWG2 | 12-107 | None |
| A0A7C1PRJ5 | 56-146 | None |
| A0A7X8UP93 | 5-77 | None |
| A0A3L7UHH6 | 83-173 | None |
| A0A1U7CW57 | 11-106 | None |
| A0A0F8Y951 | 2-78 | None |
| A0A1C3EBC5 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.