DPCstruct | MC43715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017NKK4 | 1-79 | MNNRITPYNITELKENEIFVFGSNSNGVHNGNAAATAMKFGAIMGQVVGIQGQTYAMPSKDIENLKNILMIFCYMRNNT |
| A0A109BIQ5 | 2-87 | PVFVFGSNTAGRHGKGAALFARQQHGAIHGQGEGLQGNAYAIPTKGQRPDRSLFTLPLEQIRAGVDRFLAFAASRPDIQFEVTPIG |
| A0A1M6SKK3 | 98-186 | None |
| A0A351MB57 | 4-86 | None |
| A0A3F3L161 | 6-87 | None |
| A0A143XM33 | 5-88 | None |
| A0A3A5Y2R2 | 1-90 | None |
| A0A254TI53 | 93-175 | None |
| R5BP14 | 8-96 | None |
| F8XVE5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.