DPCstruct | MC4371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7KLU4 | 9-97 | LSIRIAGNTFIPCLQAIVAKGYSIDHYYCGNTPGDWDNPQWDATKNNRTFSATSPAELLGLITMWEIRGDDWHIKKGEADLYDQLVD… |
| A0A517QXM0 | 4-83 | TTIATAGNTTVPACLAIRQLGYDLKFPSGDTCLCEAEGPLGRFIAEDPVTLLGLIKLRETRGEDWMASDAEIEAHSKLFA |
| B0BI39 | 28-112 | None |
| A0A0R3D5Z2 | 4-93 | None |
| A0A495Q750 | 1-67 | None |
| A0A7X3KA74 | 3-82 | None |
| A0A4Y3KLI1 | 99-173 | None |
| A0A0Q9U3A3 | 29-107 | None |
| A0P2G5 | 1-85 | None |
| N1ZNN3 | 8-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.