DPCstruct | MC43706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645CZ81 | 79-215 | PIDEIDRTYVGVHWNYKYLRAISAILNVTKGIVAAGDSFFRKAFGENEDEFFELLIMPRDMIMFRSFYENNGMKEEWKALYNQLTND… |
| A0A645A7F2 | 218-344 | MGKDRFNRDYLGKYWNRKYIRAVQAILNATKGKIGRGKSFFYKAFGEDESEFLNKLLYMPETYILYRLFFEEIGLTEKWWNSYNSLG… |
| A0A5M8P4G9 | 294-444 | None |
| A0A1G0SD63 | 64-188 | None |
| A0A6L9GVG2 | 431-533 | None |
| A0A2M8GGJ3 | 223-365 | None |
| A0A2S1QY56 | 486-641 | None |
| A0A180FIQ2 | 72-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.