DPCstruct | MC4370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 19.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085ZEE5 | 90-216 | NSTMLNLTLNEKKYSVTTLAQLDRIFKYSQDIQYVEFSFSGHHETAILLLKNLTYSFAIYLKFDEDTGFTTHNSKGKDDEMQDFVLT… |
| A0A517QWS6 | 11-144 | EIEYESPSGHRIQNPPASFIRRTVYEHDTSYWESGSGQGAFSCVVDGTVLSELTLTRGSESEFRLIFFNKVDKAISVAISDGKMDEY… |
| A0A4R3LBE4 | 63-211 | None |
| A0A1I2BR59 | 2-159 | None |
| A0A1M6Y9N7 | 73-231 | None |
| A0A1I6PM90 | 18-140 | None |
| A0A7C5J657 | 17-144 | None |
| A0A5R8QHW2 | 178-305 | None |
| A0A022LT86 | 120-247 | None |
| A0A6G7Y5W3 | 123-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.