DPCstruct | MC437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A049DXT9 | 50-126 | ERYLNSGLLPVDCRFCHARVAVRRLGPGHTAVQWNTEAWQRCAYFTEVRQAGGDTARTKSCPKLGDSIEHAVAEGYL |
| A0A543BZ50 | 10-94 | DLPMTPVECQRCHATVQVRKSSWQQTSVQWDEAGARTCPERRPSLIAGGIREADFFTCAGLRESIAQAAMSGTIPMAEETFEDSA |
| A0A2A3GCV3 | 1-72 | None |
| A0A6I6G3J8 | 33-113 | None |
| A0A7I7K117 | 6-83 | None |
| A0A1A3J7D2 | 71-146 | None |
| A0A1I5J4K4 | 32-104 | None |
| A0A1X1B1Y1 | 33-107 | None |
| A0A6B2RSM0 | 1-64 | None |
| A0A2A3FHT7 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.