DPCstruct | MC43697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 328 ± 43 aa |
| Standard deviation of domain lengths | 43.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6C7U5 | 1-312 | MKPVLLVVACLPLWLACGQPMDSELDGSETKLQWWLKIAPRCEGFPAKEHCDDGDTNLFNGLLCAVGVEDACDAVREGQGADGRWWR… |
| A0A0A3Y199 | 219-519 | TQADVQELKSLRQELLNGTPNAPLKSSNQHSGFAYPAKLKAGEFDDGDAAIFNGLLCASGQQIGCDAVQRMQSSSGQIWRSPDRRNT… |
| A0A7R7E3Q8 | 1-411 | None |
| A0A497BX39 | 23-344 | None |
| A0A2A6KBR7 | 3-273 | None |
| A0A2W7L9W9 | 404-707 | None |
| A0A4Q6B5Q3 | 14-373 | None |
| U5QG63 | 4-383 | None |
| A0A5C7LJZ1 | 4-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.