DPCstruct | MC43695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9BIR5 | 15-74 | TTAIASKGLSPSADIAEHIGKRRKFEIHHINPINEGGSVYDISNLTLLTPKQHIDAHSKK |
| A0A1B8YGT5 | 2-53 | KNGLSPYSPKLEQVGSRQKYEIHHVQFIKDDGSVYGLDNLRVITPKRHIEIH |
| A0A0N0XEN0 | 376-447 | None |
| A0A1Y6ISU1 | 370-429 | None |
| A0A6D1GZV5 | 17-77 | None |
| A0A357B9X6 | 1129-1203 | None |
| A0A1H3M140 | 348-427 | None |
| A0A2N0DRJ2 | 90-161 | None |
| A0A1R3UQW6 | 596-673 | None |
| A0A6M1VU75 | 447-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.