DPCstruct | MC43676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9LAT0 | 2-101 | QKRPYPPENILGLEPEFDGYEFEPAPEVKKWIWDTFIQPDGELYNEDHDHISAFEGSFFEVLWASGGFIKGERLVLGQCEKVMFRAG… |
| J3BN68 | 5-97 | SKRPIPPEDMLEDASIRFEPAHDLIEWARSSFIDETADLLNEDHAHLRFASIGALWTNVPNGRNGRRIVGQCEMGLPPAGKWSRSRI… |
| A0A8B3MSL9 | 1-78 | None |
| J2T3L7 | 1-105 | None |
| J5B0U5 | 7-88 | None |
| A0A7U4NJ97 | 5-105 | None |
| A0A3M4AVS5 | 1-98 | None |
| A0A653HUU8 | 3-107 | None |
| A0A0N8HF94 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.