DPCstruct | MC43674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EFC2 | 1-72 | MVSASRGIYKQVAPPHHSTLFRKNYTFLGVVFAGAFAFEMGFDNGMDKIWDSLNKGRQWKDIRAKYVQAADD |
| A0A1J9R9A4 | 21-128 | ASTCDSTSAQPPPPLRTPSPTLRSHNVRHCLVRLQASFLALPYARDAPANPGLSSLIKRNYVFLTTVFVGAFAVQMSFDSASDKIWD… |
| A0A665U0V2 | 20-129 | None |
| A0A6P8BEG0 | 234-318 | None |
| A0A0F8UUN3 | 7-96 | None |
| A0A423XNP7 | 7-95 | None |
| A0A1B8B3I9 | 9-118 | None |
| A0A507QPL5 | 30-162 | None |
| A0A162JUP8 | 56-173 | None |
| A0A4V3HQB0 | 18-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.