DPCstruct | MC43671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 89 ± 19 aa |
| Standard deviation of domain lengths | 19.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.78 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0168- PF11218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1BQK9 | 56-135 | TGAALDASTRLFVRGFDELLLCSSKSFGLVECAPSSPAVTVTLSQQISGSPCTLGTSFGLTASGAVWVDRGCRGQFAVRF |
| C0HK25 | 77-141 | CQTLRVESWNYKYAEKVVEGAALFINMTVEDRQSEASCDLDKSFGFYNQNSTVWVNHGCRADFNI |
| A0A5C7X849 | 97-174 | None |
| A0A0Q7WPM6 | 12-88 | None |
| A0A7V8FF69 | 60-134 | None |
| A0A1Q7SW04 | 2-82 | None |
| A0A841GTN8 | 5-91 | None |
| A0A3C0M9L9 | 176-250 | None |
| A0A7H0FZ34 | 293-363 | None |
| A0A854F349 | 3-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.