DPCstruct | MC43670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 190 ± 42 aa |
| Standard deviation of domain lengths | 41.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 99.48 |
| Assigned Pfam label(s) | CL0248- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1BN38 | 16-193 | LAPIVFPLFLTLPDVRRPDRRKWFPITFTGSICWIAGFSYLMVWWANQAGETIGIPDEVMGLTILAAGTSIPDLITSVIVAKKGFGD… |
| A0A832C7Y6 | 1-189 | ATKAEREEFEAVGVPAYLCCFPTRKRRISVIFLLLFSGSVILISVEAFAEGLVASARVFGIDEFLMVQWIAPLASEAPEFIVAVYFV… |
| A0A2G8LGC4 | 113-290 | None |
| A0A034VYY5 | 760-1002 | None |
| A0A1S3PWK4 | 160-316 | None |
| A0A061QGE4 | 102-285 | None |
| A0A340Y8A0 | 347-593 | None |
| A0A1I8IQS7 | 29-230 | None |
| A0A0W0VSP6 | 51-226 | None |
| A0A7X9HYN2 | 35-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.