DPCstruct | MC43669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 597 ± 57 aa |
| Standard deviation of domain lengths | 56.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.85 |
| Pfam Score | 76.36 |
| Assigned Pfam label(s) | PF07452- CL0451 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1BHX9 | 5-696 | LVAALRLTIRPESGQMDFSLRLSPSPSFKPDQPLYLQLIDINGEVQLQKPIVTESSRTASKVCGAWTQVPAVYKSYLDRGLLLAKVA… |
| A0A7C5LWN9 | 1-483 | MYNLEELGSSGVSGTVKFEERTDNSTLVTISLTGASGGHPAHIHANTAAETGPIVIDLTEVDASGKSETIVSAKNDGTAITYNDLIN… |
| A0A4C1U9X9 | 61-689 | None |
| A0A7E4RGB8 | 49-632 | None |
| A0A6A4VJD0 | 291-910 | None |
| A0A182TGB9 | 9-596 | None |
| A0A1S3GIF6 | 2-624 | None |
| A0A2T7PPX0 | 177-795 | None |
| A0A834MLS6 | 408-997 | None |
| A0A653CN70 | 101-716 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.