DPCstruct | MC43666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2571 |
|---|---|
| Mean domain length (aa) | 142 ± 27 aa |
| Standard deviation of domain lengths | 27.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.10 |
| Pfam Score | 95.81 |
| Assigned Pfam label(s) | CL0213- PF00057- CL0022- CL0144- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1A3H8 | 20-165 | LVLASQNPCRFGWAYFQGSCYGFGHERMTWPEAEQMCVLYEGTLAEIHSKAENDFVKQYLRNNTILINIYGAWIGGTDIFTEGTWEW… |
| A0A1I7YPV4 | 222-359 | CPSGFHYFKSFGKCVGAFDIAGRKPKNPSQMKKLCTDLKSLPVKIENKQQNDDLNHIDTWNVALIGLHIPEGQPWGKNNYRWISDDS… |
| A0A2B4SGK4 | 1006-1141 | None |
| A0A2B4SJS4 | 643-786 | None |
| A0A2B4SLL8 | 205-345 | None |
| A0A1D2N6J6 | 1-151 | None |
| A0A1H5S9P9 | 649-788 | None |
| A0A819T2R6 | 499-675 | None |
| A0A7M3RK12 | 2-222 | None |
| A0A7M3RQH8 | 420-595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.