DPCstruct | MC43662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 54 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0D782 | 1-56 | MARQRTRKSSKGCSCKKSGCLKNYCECYEFKIPCNTFCRCLGCKNTQFIHQPKQKL |
| G0QLW2 | 31-73 | IHKKGCTCKKSNCLKKYCECFNAGVLCNQNCVCDSCKNMQKEE |
| A0A0V0QQ51 | 95-152 | None |
| A0A5D2SYD4 | 24-63 | None |
| A0A4U5UHD8 | 40-92 | None |
| A0A0Q9XAJ9 | 826-884 | None |
| A0A0D9WKF0 | 92-152 | None |
| A0A835ZIN5 | 57-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.