DPCstruct | MC43661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 115 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9Q2V8 | 10-116 | AYRQSQGRTASYTKEDWKRITGEMDAIHHRMAGLLAGGVPADSEAAMDVAEEHRRFITGTYYDCGHEMHACLGEMYVADERFTATYE… |
| A0A0F4IYN4 | 28-121 | EHVDRARVHQDWDVLYREITACLNAGARPGDGEVQELVRRHFDIACRFYTPSREAYVGMALFYAEDEAMRAFHDSYHPGLVEFLGAA… |
| A0A5C5US76 | 144-240 | None |
| T0DX72 | 39-149 | None |
| A0A853AFV2 | 1-109 | None |
| A0A1K2A3S0 | 43-183 | None |
| A0A7I7UJ83 | 8-146 | None |
| A0A6N1EFK5 | 54-151 | None |
| A0A1K2HFN5 | 73-166 | None |
| A0A060JN94 | 11-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.