DPCstruct | MC43659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 177 ± 33 aa |
| Standard deviation of domain lengths | 32.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8S3I3 | 4-146 | LKTLDSKQELQNSGFGQPPPRHGLKLLVWYVQKCLDNNMLALCDPTKGEYGFHMFLNRGPRRLLPVITDKRQYRYYTIGNLHSPHAE… |
| A0A2D0QMB3 | 8-183 | EQLEQSRFGQPHPRHGLKLLYWFSNECLSLDQNDVLQLSCDPKNKDFGFHRFENRYERNSGKLLPNVAFPYYVVGNLSYPYASKLPG… |
| A0A3Q0TDN9 | 6-153 | None |
| A0A672FL05 | 3-196 | None |
| A0A3B3DKZ7 | 18-173 | None |
| A0A556TJT8 | 19-165 | None |
| A0A3B3VTY1 | 8-166 | None |
| A0A498LPQ0 | 293-462 | None |
| A0A498LUJ9 | 201-368 | None |
| A0A5J5CV00 | 25-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.