DPCstruct | MC43642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022QU39 | 10-107 | EYCREPGRNAAGETGRNAAGETAATADNMGLDMLMNMFRGLGTVGGMTTPNSSQAPPEELYATQLSQLREMGFIDTQENIRALIAAA… |
| A0A093YNQ0 | 1-76 | MGGGEGGGANPYAGFGAAGAGGATSPPPPADTRPPEEVYADQLRALNDMGFFDFEANVRALRRSGGSVQGAVEQLL |
| A0A7S3AIJ9 | 127-256 | None |
| D4ATJ4 | 542-619 | None |
| A0A7S0L6U0 | 7-113 | None |
| W7TEA5 | 16-124 | None |
| A0A448ZPD4 | 5-138 | None |
| U6JSD1 | 129-223 | None |
| A0A6A5X2W4 | 213-294 | None |
| A0A6A5U2C4 | 8-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.