DPCstruct | MC4364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 90 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 17.99 |
| Pfam Score | 80.38 |
| Assigned Pfam label(s) | CL0489- CL0036- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496QP84 | 235-331 | NRLCTKYGEKCIHSVLGSGKKRVAPSERNNYFTTRRSVHAVKFLPAGTVLSRENTALLRTEKNLRPGLPPELWDVIIGKKCIRDIPP… |
| A0A7J8EFE9 | 194-281 | VRLVERAMGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTLDMLTVKVGEPKGYPPEDIFSLVGKKVLVTIEEDDTIMEETVENH |
| A0A3S3UVU5 | 5-80 | None |
| A0A3L7PFK4 | 17-122 | None |
| A0A0B8P0H3 | 3-121 | None |
| A0A849IMI3 | 1-105 | None |
| A0A1F9TIE5 | 12-102 | None |
| A0A7V9C6V1 | 1-141 | None |
| A0A838E030 | 11-103 | None |
| A0A1V5JUI5 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.