DPCstruct | MC43638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7P3L3 | 30-161 | IMARQALHILDQEIHSAHRPEPPFRLQGSYRNMNKLAEKVSAVMNGTEIDQLISDHYRGESQLLTHGAEENLLKLAELRGQLSDEQA… |
| A0A4Q2YT69 | 102-242 | LSVRDTILRVNLQYIASAAQEEAYRMEPSFKLQGSYRNMNRIAEKVLPLMTPEEVRQIVIDHYRSESQNLTTAAEANLLKFYEMEGL… |
| A0A1B8TBZ9 | 151-285 | None |
| X0RYJ4 | 84-250 | None |
| A0A1F9N1S3 | 96-248 | None |
| A0A2X2CA61 | 124-262 | None |
| A0A7K3DGZ0 | 672-820 | None |
| A0A4Q2X0L3 | 193-329 | None |
| A0A1Z1W2T2 | 1-166 | None |
| Q9HXR4 | 1504-1644 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.