DPCstruct | MC43634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 124 ± 24 aa |
| Standard deviation of domain lengths | 24.43 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 43.92 |
| Assigned Pfam label(s) | CL0169- PF14319- CL0481- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848A1T3 | 2-114 | LLPVPYFLVTFTVPEPLRLWMRSHPDVSLDLLFAASAHALQDLARNPQRLGASLGMLGLLHTWSRTLIYHPHVHYLVPAGGLSLDQR… |
| A0A4U2DCN5 | 89-196 | VHYFMVTFTLPYQLRVLARHQPKAIYNGMFKVASGVLKDFANRQRQGELGFTAVLHTHSRQRNLHPHLHIIVAAGQYDASRQTWHKG… |
| A0A846MBJ1 | 9-170 | None |
| A0A100I159 | 196-351 | None |
| W3YLP4 | 53-153 | None |
| A0A1Q8YGR4 | 16-121 | None |
| A0A7V8YDI4 | 105-222 | None |
| A6MV72 | 258-393 | None |
| A0A3R8J2E8 | 101-232 | None |
| A0A348XIG8 | 7-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.