DPCstruct | MC4363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 55.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X1VM19 | 305-422 | WTAACKAMKLEHTLTPCTKINSKWLKDLNIRQDTIKLLEENTGKTLSDINIMNIFSGQSPKAIEIRAKINPWDFIKLKSFCTAKETQ… |
| A0A7J8EEW8 | 3-120 | LGKLNSYMQKMQLDHQLTPYTRINLKWIKDLNVTHESIKILEENVGNKMSDIIRSRIFTDTSHKATETKEKMNTWDYIKFKSFCTTK… |
| A0A2I3RJ50 | 40-176 | None |
| A0A7J7ZJF0 | 1-110 | None |
| D2IDZ7 | 390-511 | None |
| A0A7J8DIC3 | 2-121 | None |
| A0A7N9CMG9 | 120-231 | None |
| A0A7J8IZ65 | 31-141 | None |
| A0A5F7ZVI5 | 2-106 | None |
| A0A4W2EMK6 | 127-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.