DPCstruct | MC43624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 153 ± 32 aa |
| Standard deviation of domain lengths | 32.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2S7S0 | 26-177 | SFIIEKAAKLGIRHDLVEYQNHYESSYNEFEAWLSDLLQQKKPPADLEALCFSLYETAETVTMFIAGAEEWDEEGDWALAKDYAPLS… |
| A0A2U2HM43 | 1-107 | MPKTVVAYSFNLFELPPGDAKYGIELIGADEFDTDNSDWACSEIWVANPRSISIPRAFADGAWEGCLDDVRGLLTSTLSTSSATASK… |
| A0A518B2D7 | 5-203 | None |
| A0A495KQD8 | 99-255 | None |
| A0A2S8HA09 | 15-147 | None |
| A0A3B8I1U9 | 18-182 | None |
| S6ET75 | 28-197 | None |
| A0A1H5YZD8 | 1-122 | None |
| A0A238U8G6 | 149-286 | None |
| A0A1M3HM43 | 13-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.